Buy Ipamorelin 5mg Online

Buy Ipamorelin 5mg Online

Oxytocin 2mg

Details:

Unit Size:5mg/vial
Unit Quantity:10 Vials
CAS NO.:170851-70-4
Synonyms:Ipamorelin Acetate, IPAM, NNC-26-0161
Molecular Formula:C38H49N9O5
Molecular Weight:711.853
Sequence:Aib-His-D-2-Nal-D-Phe-Lys-NH2
Appearance:White Powder
Purity:98.49%
Identity (ESI-MS):711.85±0.5
Source:Chemical Synthesis
Storage:Lyophilized GHRP-2 is stable at room temperature for 90 days, however it should be stored in a freezer below -8C for any extended period of time. After reconstituting GHRP-2 should be refrigerated at temperatures not to exceed 36 F.

Ipamorelin Description:

Ipamorelin is one of the cleanest, most versatile and safest GHRP’s out there. The pentapeptide Ipamorelin is somewhat like Hexarelin, but it’s cleaner. In some ways, it acts like GHRP-6 or GHRP – 2 without the sloppy sides of elevated hunger issues.

When it comes to peptides, you are going to want a slow and steady release for a strong, clean pulse that mimics natural GH release times. This is going to be better for gains and keeping unwanted side effects down. Ipamorelin acts like a ghrelin mimetic, but, unlike GHRP-6, it has shown to be more stable in suppressing somatostatin and stimulating GH release.

Ipamorelin Application:

After an athlete administers Ipamorelin, a selective pulse is sent that stimulates the hypothalamus/pituitary to release GH. This pulse can endure for approximately three hours after injection. Once the GH pulse is sent, the cells go directly to the muscle to support development while staying clear of any possible bone or cartilage growth. This is good for Ipamorelin users, as long term usage will effect lean body muscle growth without the possibility of experiencing any bone or cartilage deformities. The same cannot be said for synthetic HGH users, who experience pronounced side effect in swelling joints and even in some cases Carpel Tunnel. Ipamorelin will increase cell synthesis, elevate secretion levels of insulin from pancreatic tissue, and increase ghrelin in the stomach – which helps release GH and control hunger. All of these functions work to promote fat loss, shuttling of nutrients, and building clean muscle mass.

Ipamorelin Benefits:

No spikes in cortisol or prolactin at lower dosages.
Increases LBM.
Lowers body fat.
Anti aging properties (faster recovery).
Improves sleep and mood.

Ipamorelin Dosage and Usage:

Ipamorelin, like other peptides, comes as a freeze dried powder that is very delicate. You can store it in the refrigerator or at room temperature before reconstituting. Once reconstituted with bacteriostatic water, the vials must be stored in a cool dry place like your refrigerator. Insulin syringes are the best way to administer it, usually via subcutaneous injection.
Of course, using iPamorelin with a GHRH like CJC w/out DAC will give the user the biggest increase in GH and IGF-1 as GHRP’s and GHRH’s work together synergetically. The average dosing for Ipamorelin is 200-300mcg two to three times daily. Twelve week cycles are quite normal and PCT would be very minimal – mini-pct is fine. If prolactin issues ever arise, there are products that help reduce prolactin and estrogen-like symptoms. These include aromatase inhibitors (Aromasin, Arimidex, Letrozole), and anti-prolactin aids like Dostinex (Cabergoline).

Advertisements

Buy Deslorelin 20mg Online

Buy Deslorelin 20mg Online

Follistatin 344 1mg

USP APIs Peptide Deslorelin CAS 57773-65-6 Powder 20mg/vial Top Quality

Quick Details:

Product name: Deslorelin
Synonyms: GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,
[D-TRP6]-LH-RH ETHYLAMIDE;(DES-GLY10,D-TRP6,PRO-NHET9)-GONADOTROPIN-RELEASING HORMONE
CAS: 57773-65-6
MF: C64H83N17O12
MW: 1282.45
Purity: 99.5% min
Mol File: 57773-65-6.mol
Appearance: White powder
MOQ: 20mg(50 vials)
Grade : Pharmaceutical Grade
Deliver methods: By express (door to door)

What is Deslorelin?
Deslorelin acetate is an injectable gonadotropin releasing hormonesuper-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).
Deslorelin is a synthetic hormone that stimulates the release of the pituitary hormones in the mare that cause ovulation from mature ovarian follicles. It’s use permits the mare to be bred at an optimal time for conception with a higher rate of pregnancy.
It is manufactured as an implant that releases the drug continually for about 72 hours. It is also available in injectable form that allows between 16 to 21 hours of activity.

Uses and application:
The Deslorelin products are currently approved for use in veterinary medicine and to promoteovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormoneand follicle-stimulating hormone by their ultimate downregulation of thepituitary gland, Deslorelin is primarily used for the initial flare effect upon the pituitary, and its associated surge of LH secretion.Suprelorin is a slowly releasing deslorelin implant used for chemical castration of dogs and ferrets. It is marketed by Virbac. Deslorelin is also used to treat benign prostate hyperplasia in dogs.

Deslorelin and horse:
Deslorelin is used to stimulate hormones which facilitate the breeding of mares at an optimal time, leading to a higher rate of successful pregnancy.
Deslorelin is regularly used in non-pregnant broodmares for the management of their heat cycle.

COA:

Single Impurity (HPLC) 1.0%max
Amino Acid Composition ±10% of theoretical
Peptide Content (N%) ≥80.0%
Water Content(Karl Fischer) ≤6.0%
Acetate Content (HPIC) ≤15.0%
MS(ESI) Consistent
Mass Balance 98.0~105.0%
Specific Rotation (20/D) -65.0~-75.0°(c=0.5 1%HAc)

Our Adwantage: 
High quality with competitive price:
1) Standard: Enterprise Standard
2) All Purity:>=99%
3) We are manufacturer and can provide high quality products with factory price.

Fast and safe delivery:
1) Parcel can be sent out in 24 hours after payment. Tracking number available
2) Secure and discreet shipment. Various transportation methods for your choice.
3) Customs pass rate: >=99%
4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe, and we have stock in there for transferring.

We have clients throughout the world: 
1) Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their desire.
2) Market feedback and goods feedback will be appreciated, meeting customers’s requirement is our responsibility.
3) High quality, competitive price, fast delivery, first-class service gain the trust and praise from the customers.

Everybody is talking the similar words, what I want to say is: Just give me a chance, Just have a try on me, maybe you will get a surprise from me!

Buy Long R3 IGF-1 (IGF-1 LR3) 0.1mg Online

Buy Long R3 IGF-1 (IGF-1 LR3) 0.1mg Online

IGF1 LR3

IGF-1 LR3 Details:

Specification: 1mg,0.1mg per ml
Purity: >95% by HPLC
Appearance: Sterile filtered solution
AA Sequence: GPETLCGAEL VDALQFVCGD RGFYFNKPTG YGSSSRRAPQ TGIVDECCFR SCDLRRLEMY CAPLKPAKSA
Upon reconstitution, the preparation is stable when stored at 2-8°C. For maximum stability, apportion the reconstituted preparation into working aliquots and store at -20°C. Avoid repeat freeze/thaw cycles.

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

IGF-1 LR3 Description:

IGF1 LR3 allows for many of the growth-promoting effects of growth hormone insulin-like growth factors also know as IGF’s. IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development. IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3.

The Long R3 IGF-1 version is significantly more potent than regular IGF-1. The enhanced potency is due to the decreased binding of IGF1 LR3 to all known IGF binding proteins. These binding proteins normally inhibit the biological actions of IGF’s therefore IG-1 LR3 has been shown to have increased efficacy and function .

This IGF-1 LR3 analog of IGF-1 has been created with the purpose of increasing the biological activity of the IGF peptide.

IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3. This is a human recombinant, single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9200 Daltons. IGF1 mediates many of the growth-promoting effects of growth hormone (GH; MIM 139250). The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed ‘sulfation factor,’ which later became known as ‘somatomedin’.

IGF-1 LR3 is the primary protein involved in responses of cells to growth hormone (GH): that is, IGF-I is produced in response to GH and then induces cellular activities. One such example is muscle growth or hyperplasia. This compound also makes the human body more sensitive to insulin. It is the most potent growth factor found in the human body. IGF-1 causes muscle cell hyperplasia, which is an actual splitting and forming of new muscle cells.

The most effective form of IGF-1 is considered to be IGF-1 LR3. This formula has been chemically altered to avoid binding to proteins in the human body, and to increase the half life, approximately 20-30 hours.

The Sequence of IGF-1 LR3 and Muscle Growth:

The polypeptide Long R3 Insulin-like Growth Factor-I (IGF1 LR3) is an 83 amino acid analog of IGF-I actually comprising the complete IGF-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IGF-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.” IGF stands for insulin-like growth factor. Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGF is active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 LR3 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF-1 LR3 prevents insulin from transporting glucose across cell membranes. As a result the cells have to switch to burning off fat as a source of energy.

IGF-1 LR3 builds new muscle tissue by promoting nitrogen retention and protein synthesis. This causes the growth of muscles through both hyperplasia (which is an increase in number of muscle cells) and mitogenesis (which is the actual growth of new muscle fibers). Thus IGF-1 LR3 not only makes muscle fibers bigger, it makes more of them as well. Therefore, IGF can actually change the genetic capabilities in terms of muscle tissue and cell count. IGF increases and differentiates the number and types of cells present.

IGF-1 LR3 is a synthetic analog of the naturally existing insulin growth factor (IGF) which is a 93 amino acid residue. Modifications of the natural form occurred with the substitution of the Arg with Glu at the position 3, giving a code R3, and also an extension of a 13 amino acid at the B-terminus. Just like IGF-1, R3 has been shown to induce the development and growth of cells.

The studies on transgenic and knockout mice have shown that it can control its development and growth. It plays an important role as regulator in the G1 to S phase of the cell cycle. When applied to cardiomyocyte cultures, R3 have shown a large increase in proliferating cell nuclear antigen expression and in several cyclins involved in cell progression as well as in bromodeoxyuridien (BrdU) labeling (Kajstura et al. 1994). Other effects it has on cell lines are increased cell survival, inhibition of the apoptotic pathways, culture longevity and increased recombination of protein production (Fang et al. 1997). In another study, the application of the LR3 IGF-1 has led to an increase in the myocyte bromodeoxyuridine uptake by three to fivefold. But it has also shown that IGF-1 LR3 actions have been blocked by the ERK and P13K labeling which completely abolished the BrdU uptake. Furthermore, ut has been shown that in mycocytes, IGF-1 R3 stimulates the cardiomyocyte division in vivo (Sundgren et al. 2003). It has also been suggested that IGF-1-Long 3R is more potent than the IGF-1 because of its low binding capacity with all known IGF binding proteins (Tomas et al. 1995). In another investigation, feeding of LR3-IGF-1 in different amounts to investigate the effects on somatotropic axis (plasma levels of IGF-1 and 2, IGFBPs) was done. They have reported that plasma Long-R3 increased when administered subcutaneously but with no such behavior when administered orally. Furthermore, LR3 lowered the levels of native IGF-1 in rbGH-injected in calves, but L-R3 increased the amounts of IGF-II concentrations when administered with L-R3 subcutaneously. The parenteral administration of the Long R3 IGF-1 decreased the growth hormone concentration but did not affect the secretory system. It was also reported that the somatotrophic acis is basically functioning in neonatal calves and can be influenced by nutrition, growth hormone and Long-R3-IGF-1 (IGF1-LR3). (Hammon and Blum 1997).

The Half-Life of IGF-1 LR3 and its Effects of IGF-1:

It has a considerably longer half-life than other form, nearly 20-30 hours. When IGF-1 LR3 is active, has multiple effects on tissues in muscle cells. It plays a essential role in muscle renewal. IGF-1 LR3 encourages both increase as well distinction of stem cells. IGF-1 LR3 increases satellite cell activity, muscle DNA, muscle protein content, muscle weight and muscle cross sectional area. The importance of IGF-1 LR3 lies in the fact that all of its obvious effects work to induce muscle growth. These effects are enhanced when combined with weight training.

Protein creation is better along with amino acid absorption as a source of energy. It enhances use of fat as energy. In lean tissue, IGF-1 LR3 prevents insulin form carrying glucose across cell membranes, as a result, the cells have to change to burning off fat as a source of energy. IGF-1 LR3 also mimics insulin in the human body.

Perhaps the most remarkable also strong influence it has on the human body is its ability to cause hyperplasia, which is an definite splitting of cells. Hypertrophy is what ensues during weight training; it is an increase in the size of muscle cells. Adult humans have a fixed number of muscle cells, that can become larger with training, however the number of muscle sells does not increase. But, with this preparation use you are able to induce hyperplasia which actually increases the number of muscle cells present in the muscle. Research studies show that with weight training the new cells develop faster and become stronger and more dense.
IGF-1 LR3 used in CLINICAL RESEARCH:

IGF-1 LR3 plays an important part in childhood growth and continues to have results in adults. It is made in the human body and is at ideal levels during puberty. In most studies, the maximum active length for research studies IGF-1 LR3 is 50 days on also 20-40 days off. The most common range used during clinical research is typically between 20mcg to 120mcg per day.

During puberty, IGF is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF does in the human body; among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, decreased protein degradation and increased RNA synthesis.

Perhaps the most interesting and potent effect IGF has on the human body is its ability to cause hyperplasia, which is an actual split-ting of cells.

In muscle cells, proteins and their cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF prevents insulin from transporting glucose across cell membranes. As a result, the cells have to switch to burning off fat as a source of energy.

Research Use of IGF-1 LR3

– enlarged amino acid transporting cells
– increased protein production
– reduced protein degradation
– amplified glucose transporting
– augmented RNA combination

Buy IGF-1 LR3 1mg Online

Buy IGF-1 LR3 1mg Online

Triptorelin 2mg

IGF-1 LR3 Details:

Specification: 1mg,0.1mg per ml
Purity: >95% by HPLC
Appearance: Sterile filtered solution
AA Sequence: GPETLCGAEL VDALQFVCGD RGFYFNKPTG YGSSSRRAPQ TGIVDECCFR SCDLRRLEMY CAPLKPAKSA
Upon reconstitution, the preparation is stable when stored at 2-8°C. For maximum stability, apportion the reconstituted preparation into working aliquots and store at -20°C. Avoid repeat freeze/thaw cycles.

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

IGF-1 LR3 Description:

IGF1 LR3 allows for many of the growth-promoting effects of growth hormone insulin-like growth factors also know as IGF’s. IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development. IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3.

The Long R3 IGF-1 version is significantly more potent than regular IGF-1. The enhanced potency is due to the decreased binding of IGF1 LR3 to all known IGF binding proteins. These binding proteins normally inhibit the biological actions of IGF’s therefore IG-1 LR3 has been shown to have increased efficacy and function .

This IGF-1 LR3 analog of IGF-1 has been created with the purpose of increasing the biological activity of the IGF peptide.

IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3. This is a human recombinant, single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9200 Daltons. IGF1 mediates many of the growth-promoting effects of growth hormone (GH; MIM 139250). The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed ‘sulfation factor,’ which later became known as ‘somatomedin’.

IGF-1 LR3 is the primary protein involved in responses of cells to growth hormone (GH): that is, IGF-I is produced in response to GH and then induces cellular activities. One such example is muscle growth or hyperplasia. This compound also makes the human body more sensitive to insulin. It is the most potent growth factor found in the human body. IGF-1 causes muscle cell hyperplasia, which is an actual splitting and forming of new muscle cells.

The most effective form of IGF-1 is considered to be IGF-1 LR3. This formula has been chemically altered to avoid binding to proteins in the human body, and to increase the half life, approximately 20-30 hours.

The Sequence of IGF-1 LR3 and Muscle Growth:

The polypeptide Long R3 Insulin-like Growth Factor-I (IGF1 LR3) is an 83 amino acid analog of IGF-I actually comprising the complete IGF-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IGF-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.” IGF stands for insulin-like growth factor. Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGF is active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 LR3 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF-1 LR3 prevents insulin from transporting glucose across cell membranes. As a result the cells have to switch to burning off fat as a source of energy.

IGF-1 LR3 builds new muscle tissue by promoting nitrogen retention and protein synthesis. This causes the growth of muscles through both hyperplasia (which is an increase in number of muscle cells) and mitogenesis (which is the actual growth of new muscle fibers). Thus IGF-1 LR3 not only makes muscle fibers bigger, it makes more of them as well. Therefore, IGF can actually change the genetic capabilities in terms of muscle tissue and cell count. IGF increases and differentiates the number and types of cells present.

IGF-1 LR3 is a synthetic analog of the naturally existing insulin growth factor (IGF) which is a 93 amino acid residue. Modifications of the natural form occurred with the substitution of the Arg with Glu at the position 3, giving a code R3, and also an extension of a 13 amino acid at the B-terminus. Just like IGF-1, R3 has been shown to induce the development and growth of cells.

The studies on transgenic and knockout mice have shown that it can control its development and growth. It plays an important role as regulator in the G1 to S phase of the cell cycle. When applied to cardiomyocyte cultures, R3 have shown a large increase in proliferating cell nuclear antigen expression and in several cyclins involved in cell progression as well as in bromodeoxyuridien (BrdU) labeling (Kajstura et al. 1994). Other effects it has on cell lines are increased cell survival, inhibition of the apoptotic pathways, culture longevity and increased recombination of protein production (Fang et al. 1997). In another study, the application of the LR3 IGF-1 has led to an increase in the myocyte bromodeoxyuridine uptake by three to fivefold. But it has also shown that IGF-1 LR3 actions have been blocked by the ERK and P13K labeling which completely abolished the BrdU uptake. Furthermore, ut has been shown that in mycocytes, IGF-1 R3 stimulates the cardiomyocyte division in vivo (Sundgren et al. 2003). It has also been suggested that IGF-1-Long 3R is more potent than the IGF-1 because of its low binding capacity with all known IGF binding proteins (Tomas et al. 1995). In another investigation, feeding of LR3-IGF-1 in different amounts to investigate the effects on somatotropic axis (plasma levels of IGF-1 and 2, IGFBPs) was done. They have reported that plasma Long-R3 increased when administered subcutaneously but with no such behavior when administered orally. Furthermore, LR3 lowered the levels of native IGF-1 in rbGH-injected in calves, but L-R3 increased the amounts of IGF-II concentrations when administered with L-R3 subcutaneously. The parenteral administration of the Long R3 IGF-1 decreased the growth hormone concentration but did not affect the secretory system. It was also reported that the somatotrophic acis is basically functioning in neonatal calves and can be influenced by nutrition, growth hormone and Long-R3-IGF-1 (IGF1-LR3). (Hammon and Blum 1997).

The Half-Life of IGF-1 LR3 and its Effects of IGF-1:

It has a considerably longer half-life than other form, nearly 20-30 hours. When IGF-1 LR3 is active, has multiple effects on tissues in muscle cells. It plays a essential role in muscle renewal. IGF-1 LR3 encourages both increase as well distinction of stem cells. IGF-1 LR3 increases satellite cell activity, muscle DNA, muscle protein content, muscle weight and muscle cross sectional area. The importance of IGF-1 LR3 lies in the fact that all of its obvious effects work to induce muscle growth. These effects are enhanced when combined with weight training.

Protein creation is better along with amino acid absorption as a source of energy. It enhances use of fat as energy. In lean tissue, IGF-1 LR3 prevents insulin form carrying glucose across cell membranes, as a result, the cells have to change to burning off fat as a source of energy. IGF-1 LR3 also mimics insulin in the human body.

Perhaps the most remarkable also strong influence it has on the human body is its ability to cause hyperplasia, which is an definite splitting of cells. Hypertrophy is what ensues during weight training; it is an increase in the size of muscle cells. Adult humans have a fixed number of muscle cells, that can become larger with training, however the number of muscle sells does not increase. But, with this preparation use you are able to induce hyperplasia which actually increases the number of muscle cells present in the muscle. Research studies show that with weight training the new cells develop faster and become stronger and more dense.
IGF-1 LR3 used in CLINICAL RESEARCH:

IGF-1 LR3 plays an important part in childhood growth and continues to have results in adults. It is made in the human body and is at ideal levels during puberty. In most studies, the maximum active length for research studies IGF-1 LR3 is 50 days on also 20-40 days off. The most common range used during clinical research is typically between 20mcg to 120mcg per day.

During puberty, IGF is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF does in the human body; among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, decreased protein degradation and increased RNA synthesis.

Perhaps the most interesting and potent effect IGF has on the human body is its ability to cause hyperplasia, which is an actual split-ting of cells.

In muscle cells, proteins and their cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF prevents insulin from transporting glucose across cell membranes. As a result, the cells have to switch to burning off fat as a source of energy.

Research Use of IGF-1 LR3

– enlarged amino acid transporting cells
– increased protein production
– reduced protein degradation
– amplified glucose transporting
– augmented RNA combination

Buy 99%+ Purity Glutathione (GSH) CAS No: 70-18-8

Buy 99%+ Purity Glutathione (GSH) CAS No: 70-18-8

Gonadorelin 2mg

99%+ Purity Glutathione (GSH) CAS No: 70-18-8

Product Name: Glutathione
Synonym: L-Glutathione Reduced; 5-L-Glutamyl-L-cysteinylglycine; GAMMA-GLU-CYS-GLY; GAMMA-L-GLUTAMYL-CYSTEINYL GLYCINE; GAMMA-L-GLUTAMYL-L-CYSTEINYGLYCINE; GAMMA-L-GLUTAMYL-L-CYSTEINYL-GLYCINE; G-L-GLUTAMYL-L-CYSTEINGLYCINE; G-L-GLUTAMYL-L-CYSTEINYLGLYCINE; GLU(CYS-GLY); GLUTAMYLCYSTEINYLGLYCINE, REDUCED; GLUTATHIONE; GLUTATHIONE, REDUCED; GLUTATHIONE REDUCED FORM; GLUTATHION (REDUCED); GSH; GSI; H-GAMMA-GLU-CYS-GLY-OH; L-GLUTATHIONE; L-GLUTATHIONE REDUCED; L-GLUTATHIONE (REDUCED FORM); REDUCED GLUTATHIONE; ;
L-Glutathione Reduced CAS No.: 70-18-8
L-Glutathione Reduced EINECS No.: 200-725-4
L-Glutathione Reduced Molecular formula: C20H32N6O12S2
L-Glutathione Reduced Molecular weight: 612.63
L-Glutathione Reduced Packing: 1KG/Bag
L-Glutathione Reduced Content: 99%
L-Glutathione Reduced Appearance: White powder
L-Glutathione Reduced Catagory: Pharmaceutical raw material

Glutathione (GSH) Specifications:

COA

Test Items Specification
Characters: white powder
Appearance Of Solution: Clear and colorless
Specific optical rotation: +89°- +93°
Related Substances: Meets the requirements
Heavy Metals: ≤10PPM
Loss On Drying: ≤1.0%
Sulfated Ash: ≤0.1%
Assay: 98.5% – 101.0%
Storage: Store Protected From Light

Glutathione (GSH) Description:

1. Glutathione is a non-protein sulfhydryl tripeptide compound formed by glutamic acid, cysteine and glycine through peptide bond condensation. It is an active short peptide with wide usage.
2. Glutathione is soluble in water, dilute alcohol, liquid ammonia and dimethyl formamide, but insoluble in ethanol, ether and acetone. The solid of glutathione is relative stable and its aqueous solution can easily be oxidized in the air.

Glutathione (GSH) Application and Function:

Reduced L-glutathione is a well-known tripeptide, -glutamyl-cysteinyl-glycine, abbreviated GSH. It is the most abundant low-molecular-weight thiol, and GSH/glutathione disulfide is the major redox couple in animal cells. “Glutathione deficiency contributes to oxidative stress, which plays a key role in aging and the pathogenesis of many diseases (including kwashiorkor, seizure, Alzheimer’s disease, Parkinson’s disease, liver disease, cystic fibrosis, sickle cell anemia, HIV, AIDS, cancer, heart attack, stroke, and diabetes).

Enhancing the immune system:

Body’ s immune activity, involving unimpeded multiplication of lymphocytes and antibody production, requires maintenance of normal levels of glutathione inside the lymphocytes.
Antioxidant and free radical scavenger:

Glutathione plays a central protective role against the damaging effects of bacteria, viruses, pollutants and free radicals.
Regulator of other antioxidants:

Without glutathione, other important antioxidants such as vitamins C and E cannot do their job adequately to protect your body against disease.

Detoxifying agent:

Another major function of glutathione is in the detoxification of foreign chemical compounds such as carcinogens and harmful metabolites.

Skin whitening:

Dermatologists prescribe Glutathione for its only side effect: Whitening of dark skin. People with darker skin tone report that taking Glutathione capsules along with vitamin C for three to six months or more actually lightens the color of their skin.

Buy Eptifibatide 1mg Online

Buy Eptifibatide 1mg Online

Tesamorelin 2mg

Brand Name:HKYCGC
Product Name :Eptifibatide
Certification:SGS/ISO9001/Kosher
Place of Origin:China
Minimum Order Quantity:10 vials
Price:Negotiation
Payment Terms:Western Union,Money Gram ,Bitcoin or T/T
Supply Ability:5000 Vial per month
Delivery Time:After receipt of your payment
Packaging Details:Original Kits or as requirements
Product Name:Eptifibatide,Peptide Hormones,Bodybuilding Supplements
Manufacturer:HKYCGC
Contact Person:Lynn
Email:beststeroids@chembj.com
Skype:best.steroids

Product Name:Eptifibatide
Unit Size :1 mg/vial
Unit Quantity :1 Vial
Appearance :White Powder
Purity :99%
Source :Chemical Synthesis
Storage :Lyophilized Eptifibatide is stable at room temperature for 90 days,however it should be stored in a freezer below -8C for any extended period of time. After reconstituting MGF should be refrigerated at temperatures not to exceed 36 F.

Description:

Eptifibatide (Integrilin, Millennium Pharmaceuticals, also co-promoted by Schering-Plough/Essex), is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class.Eptifibatide is a cyclic heptapeptide derived from a protein found in the venom of the southeastern pygmy rattlesnake (Sistrurus miliarius barbouri). It belongs to the class of the arginin-glycin-aspartat-mimetics and reversibly binds to platelets. Eptifibatide has a short half-life. The drug is the third inhibitor of GPIIb/IIIa that has found broad acceptance after the specific antibody abciximab and the non-peptide tirofiban entered the global market.

Integrilin is sold in two strengths, globally: vials containing 2 mg/ml (20 mg totally) and 0.75 mg/ml (75 mg totally). A third size is sold in the US: 100 ml vials containing 2 mg/ml (200 mg totally).

Indications:

Eptifibatide is used to reduce the risk of acute cardiac ischemic events (death and/or myocardial infarction) in patients with unstable angina or non-ST-segment-elevation (e.g., non-Q-wave) myocardial infarction (i.e., non-ST-segment elevation acute coronary syndromes) both in patients who are to receive non surgery (conservative) medical treatment and those undergoing percutaneous coronary intervention (PCI).

The drug is usually applied together with aspirin or clopidogrel and (low molecular weight or unfractionated) heparin. Additionally, the usual supportive treatment consisting of applications of nitrates, beta-blockers, opioid analgesics and/or benzodiazepines should be employed as indicated. Angiographic evaluation and other intensive diagnostic procedures may be considered a first line task before initiating therapy with eptifibatide.

The drug should exclusively be used in hospitalized patients both because of the serious degree of patients’ illness and because of the possible side-effects of eptifibatide.

Buy Epitalon 10mg Online

Buy Epitalon 10mg Online

Epitalon 10mg

Brand Name:HKYCGC
Product Name :Epitalon
Certification:SGS/ISO9001/Kosher
Place of Origin:China
Minimum Order Quantity:10 vials
Price:Negotiation
Payment Terms:Western Union,Money Gram ,Bitcoin or T/T
Supply Ability:5000 Vial per month
Delivery Time:After receipt of your payment
Packaging Details:Original Kits or as requirements
Product Name:Epitalon,Peptide Hormones,Bodybuilding Supplements
Manufacturer:HKYCGC
Contact Person:Lynn
Email:beststeroids@chembj.com
Skype:best.steroids

Product Name:Epitalon
Unit Size :10 mg/vial
Unit Quantity :1 Vial
Appearance :White Powder
Purity :98%
Source :Chemical Synthesis
Storage :Lyophilized Epitalon is stable at room temperature for 90 days,however it should be stored in a freezer below -8C for any extended period of time. After reconstituting MGF should be refrigerated at temperatures not to exceed 36 F.

Epitalon – What is it and how does it work?

Epitalon (a.k.a. epithalon or epithalone) is a synthetically-derived tetrapeptide, meaning that it consists of four amino acid chains. It was discovered by the Russian scientist Professor Vladimir Khavinson, who then conducted epitalon-related research for the next 35 years in both animal and human clinical trials. The results were astounding. For the first time ever, human clinical trials proved beyond doubt that a substance consisted of powerful life extension and anti-aging properties.

nouvelle-vie-logo-epitalon-click-ENEpitalon’s primary role is to increase the natural production of telomerase, a natural enzyme that helps cells reproduce telomeres, which are the protective parts of our DNA. This allows the replication of our DNA so the body can grow new cells and rejuvenate old ones.

Younger people produce a relatively large amount of telomerase and longer telomeres. The longer the telomere strands are, the better cell health and replication they provide. However, as people age, the production of telomerase falls and consequently cell replication and health decline. This is the main reason that people age.

Numerous studies have shown the importance of telomerase production and telomere rejuvenation in fighting the symptoms of aging. In one such study conducted on 913 pairs of twins, the twin with stronger telomerase production looked younger and had better health than his/her twin counterpart. In another study of 38 people who were 100 years or older, the healthiest participants had the strongest and longest telomeres.

As epitalon has been shown to increase the production of telomerase which in turn strengthens and lengthens telomeres, this means that epitalon can play a vital role in decreasing the aging process and thus extending human longevity.

This breakthrough discovery in understanding telomerase production shows that epitalon is the only known substance to increase telomerase production and telomere strand length, which are primary factors in fighting aging.

Epitalon – The benefits

As a result of epitalon’s effect on telomerase production, the benefits are unique and far-reaching. Benefits of epitalon include:

Increase of human lifespan
Significant boosting of energy levels
Promotion of deeper sleep
Delay and prevention of age-related diseases such as cancer, heart disease and dementia
Improvement of skin health and appearance
Healing of injured and deteriorating muscle cells
The range of benefits that epitalon provides are immense and cannot be squeezed into a single article, but the following will indicate what research so far has shown epitalon can do. If there is one particular benefit of epitalon, it is that epitalon lets us live longer and healthier.

Epitalon – A cancer-preventing peptide

Cancer comes in the form of malignant tumors. Epitalon has been shown to inhibit the growth of cancerous tumors, enabling a longer and healthier life in the future.

Epitalon fights cancer by preventing the occurrence of early-stage tumors. This can be explained by looking at the link between the human pineal gland and cancer. The pineal gland secretes a pineal hormone called melatonin, which is responsible for sleep patterns and numerous other functions. According to studies, there is an inverse relationship between melatonin secretion and malignant tumor growth, and epitalon has been found to activate melatonin secretion and therefore prevent cancer in its initial stages. Specifically, epitalon decalcifies and stimulates the pineal gland, enabling it to increase production of melatonin and prevent the growth of malignant tumors.

Epitalon – Promoting normal deep sleep patterns

Epitalon stimulates production of melatonin through its action on the pineal gland, and this is why people taking epitalon have reported better sleep patterns and increased deep sleep, which is essential for the body to repair itself and strengthen the immune system.

Epitalon – A powerful antioxidant

Research has shown that epitalon is a powerful antioxidant that eliminates oxygen-free radicals responsible for damaging and killing cells. This process, known as oxidative stress, is the root cause of a wide variety of age-related diseases. It is important to note that the human lifespan is inversely related to the number of oxygen-free radicals in the human body, and epitalon is responsible for slowing down and killing these killer radicals. Since free radicals are the main source of degenerative diseases, eliminating them prevents diseases such as cancer, dementia, Alzheimer’s, muscle and joint pain, heart disease, and more.

Epitalon – Increasing human lifespan

The unique makeup of humans is determined by our DNA strands. On the tip of each DNA strand are telomeres, which prevent the loss of vital genetic information that happens each time a cell divides. Every time a cell divides, the telomeres get shorter. The more frequent the cell division, the shorter telomeres become, until they become too short, preventing further cell division, growth, and rejuvenation. Numerous studies have shown that the shortening of telomeres is linked to age-related diseases and is a good predictor of early death.

However, there is an enzyme produced naturally in our body called telomerase (not to be confused with ‘telomeres’) which reverses the process of telomere shortening and degradation. Unfortunately our telomerase production declines significantly as we age.

So, when telomerase production is reactivated, cells can exceed their time limit and continue to divide in a healthy manner, allowing us to live longer. This is exactly what epitalon does. It reactivates the production of telomerase which in turn strengthens and elongates the telomeres in our cell’s DNA strands. This decreases cell death and degeneration, extending the lifespan of our cells and preventing a plethora of age-related diseases.

Early research into epitalon found that people who took epitalon had about a 25% longer life than their non-epitalon counterparts. These early studies triggered further studies which corroborated the initial findings. One of these studies reported that epitalon increased the lifespan of elderly and senile individuals by an incredible 50%.

Epitalon – Allowing a longer, healthier life

Through its stimulating action on telomerase production and the pineal gland, epitalon plays an important role in inhibiting cancerous tumor growth, increasing the effectiveness of deep sleep, preventing a wide variety of age-related diseases through its elimination of free radicals, and, most importantly, increasing human lifespan. In addition to all of this, it also promotes improved skin health and gives joint and muscle pain relief, the latter being a very common symptom of aging.

Epitalon/Epithalon market availability and dosing

Epitalon was rarely heard of just until a few years ago but it is now available in powder and capsule form, which ensures optimal absorption. Epitalon supplements are marketed under the names ‘Epitalon’ or ‘Epithalon’ or ‘A.G.A.G.’. The recommended adult dosage is from 1 to 50 mg daily (with an average dosage of 2-

Buy GDF-8 1mg Online

Buy GDF-8 1mg Online

GDF-8 1mg

Brand Name:HKYCGC
Product Name :GDF-8
Certification:SGS/ISO9001/Kosher
Place of Origin:China
Minimum Order Quantity:10 vials
Price:Negotiation
Payment Terms:Western Union,Money Gram ,Bitcoin or T/T
Supply Ability:5000 Vial per month
Delivery Time:After receipt of your payment
Packaging Details:Original Kits or as requirements
Product Name:GDF-8,Peptide Hormones,Bodybuilding Supplements
Manufacturer:HKYCGC
Contact Person:Lynn
Email:beststeroids@chembj.com
Skype:best.steroids

Product Name:GDF-8
Unit Size :1 mg/vial
Unit Quantity :1 Vial
Synonyms :Myostatin
Appearance :White Powder
Purity :99%
Source :Chemical Synthesis
Storage :Lyophilized GDF-8 is stable at room temperature for 90 days,however it should be stored in a freezer below -8C for any extended period of time. After reconstituting MGF should be refrigerated at temperatures not to exceed 36 F.

Description

Nature:Recombinant
Source:Escherichia coli
Amino Acid Sequence
Accession:O14793
Species:Human
Sequence:The sequence of the first five N-terminal amino acids was determined and was found to be Asp-Phe-Gly-Leu-Asp.
Additional sequence information:The sequence of the first five N-terminal amino acids was determined and was found to be Asp-Phe-Gly-Leu-Asp so starting at aa 267.

Abstract

Myostatin (GDF-8) is a member of the transforming growth factor-beta (TGF-beta) superfamily that is highly expressed in skeletal muscle, and myostatin loss-of-function leads to doubling of skeletal muscle mass. Myostatin-deficient mice have been used as a model for studying muscle-bone interactions, and here we review the skeletal phenotype associated with altered myostatin signaling. It is now known that myostatin is a key regulator of mesenchymal stem cell proliferation and differentiation, and mice lacking the myostatin gene show decreased body fat and a generalized increase in bone density and strength. The increase in bone density is observed in most anatomical regions, including the limbs, spine, and jaw, and myostatin inhibitors have been observed to significantly increase bone formation. Myostatin is also expressed in the early phases of fracture healing, and myostatin deficiency leads to increased fracture callus size and strength. Together, these data suggest that myostatin has direct effects on the proliferation and differentiation of osteoprogenitor cells, and that myostatin antagonists and inhibitors are likely to enhance both muscle mass and bone strength.

Specifications

Biological activity:The ED50 as determined by the inhibition of the proliferation of MPC-11 cells is < 20ng/ml, corresponding to a Specific Activity of 50,000units/mg.

Applications:

Western blot
Functional Studies
SDS-PAGE

Purity:> 95 % SDS-PAGE.
This product is purified by proprietary chromatographic techniques. Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form:Lyophilised
Additional notes:For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Preparation and Storage

Stability and Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None.
Additives: None.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

Reconstitution

Reconstitute in sterile 20mM HCl at 0.1 mg/ml, which can then be further diluted to other aqueous solutions.

General Info

Alternative names

GDF 8
GDF-8
GDF8
GDF8_HUMAN
Growth differentiation factor 8
Growth/differentiation factor 8
MSLHP
MSTN
Myostatin
OTTHUMP00000163498

Function

Acts specifically as a negative regulator of skeletal muscle growth.

Sequence similarities

Belongs to the TGF-beta family.

Cellular localization

Secreted.

Buy Follistatin 344 Peptide 1mg Online

Buy Follistatin 344 Peptide 1mg Online

Follistatin 344 1mg

Brand Name:HKYCGC

Product Name :Follistatin 344

Certification:SGS/ISO9001/Kosher

Place of Origin:China

Minimum Order Quantity:10 vials

Price:Negotiation

Payment Terms:Western Union,Money Gram ,Bitcoin or T/T

Supply Ability:5000 Vial per month

Delivery Time:After receipt of your payment

Packaging Details:Original Kits or as requirements

Product Name:Follistatin,Peptide Hormones,Bodybuilding Supplements

Manufacturer:HKYCGC

Contact Person:Lynn

Email:beststeroids@chembj.com

Skype:best.steroids

 

Product Name:Follistatin 344

Unit Size :1 mg/vial

Unit Quantity :1 Vial

Synonyms :FST, FS, Activin-binding protein.

Appearance :Sterile Filtered White lyophilized (freeze-dried) powder.

Purity :95%

Source :Chemical Synthesis

Storage :Lyophilized Follistatin 344 is stable at room temperature for 90 days,however it should be stored in a freezer below -8C for any extended period of time. After reconstituting MGF should be refrigerated at temperatures not to exceed 36 F.

Description

Follistatin 344 is a naturally occurring human peptide and a potent inhibitor of myostatin. Myostatin encourages the degradation of myotubes (skeletal muscle fibers) therefore inhibition of myostatin will ultimately result in increased muscle mass by preventing degradation.Follistatin is being studied for its role in regulation of muscle growth, as an antagonist to myostatin (also known as GDF-8, a TGF superfamily member). Lee & McPherron demonstrated that inhibition of GDF-8, either by genetic elimination (knockout) or by increasing the amount of follistatin, resulted in greatly increased muscle mass.In 2009, research with macaque monkeys demonstrated that regulating follistatin via gene therapy also resulted in muscle growth and increases in strength.A study has also shown that increased levels of follistatin, by leading to increased muscle mass of certain core muscular groups, can increase life expectancy in cases of spinal muscular atrophy (SMA) in animal models.It is also being investigated for its involvement in polycystic ovary syndrome (PCOS), though there is debate as to its direct role in this infertility disease.

Follistatin (FS) was initially identified as a follicle-stimulating hormone inhibiting substance found in ovarian follicular fluid. FS is a high-affinity activin-binding protein that can act as an activin antagonist. Two alternatively spliced follistatin mRNAs exist, encoding mature FS with 288 amino acid (aa) residues (FS-288) and 315 aa residues (FS-315). Natural FS purified from porcine ovaries is primarily a carboxy-terminal truncated form of FS-315 composed of 300 aa residues.

Introduction:

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. Follistatin binds directly to activin and functions as an activin antagonist. specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (fsh).

Description:

Follistatin Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 288 amino acids and having a total molecular mass of 31.5kDa.

The FST is purified by proprietary chromatographic techniques.

Source:         

Escherichia Coli.

Formulation:Lyophilized from a concentrated (1mg/ml) solution containing no additives.

Solubility:It is recommended to reconstitute the lyophilized Follistatin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability:Lyophilized Follistatin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Please prevent freeze-thaw cycles.

Purity:

Greater than 95.0% as determined by(a) Analysis by RP-HPLC.

(b) Analysis by SDS-PAGE.

Amino acid sequence:The sequence of the first five N-terminal amino acids was determined and was found to be Gly-Asn-Cys-Trp-Leu.

Biological Activity:

The activity is determined by the ability to neutralize Activin A inhibitory effect of mouse MPC-11 cells. The expected ED50 is 0.1-0.4 µg/ml in the presence of 7.5 ng/ml Activin A.

Usage:

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

Buy Follistatin 315 1mg Online

Follistatin 315 1mg

Follistatin 315 1mg

Brand Name:HKYCGC
Product Name :Follistatin 315
Certification:SGS/ISO9001/Kosher
Place of Origin:China
Minimum Order Quantity:10 vials
Price:Negotiation
Payment Terms:Western Union,Money Gram ,Bitcoin or T/T
Supply Ability:5000 Vial per month
Delivery Time:After receipt of your payment
Packaging Details:Original Kits or as requirements
Product Name:Follistatin 315,Peptide Hormones,Bodybuilding Supplements
Manufacturer:HKYCGC
Contact Person:Lynn
Email:beststeroids@chembj.com
Skype:best.steroids

Product Name:Follistatin 315
Unit Size :1 mg/vial
Unit Quantity :1 Vial
Synonyms :Follistatin
Appearance :White Powder
Purity :99%
Source :Chemical Synthesis
Storage :Lyophilized Follistatin 315 is stable at room temperature for 90 days,however it should be stored in a freezer below -8C for any extended period of time. After reconstituting MGF should be refrigerated at temperatures not to exceed 36 F.
Follistatin 315 (FST-315)
Follistatin (FST) is a secreted glycoprotein that was first identified as a follicle­stimulating hormone inhibiting substance in ovarian follicular fluid (1, 2). Human Follistatin cDNA encodes a 344 amino acid (aa) protein with a 29 aa signal sequence, an N­terminal atypical TGF binding domain, three Follistatin domains that contain EGF­like and kazal­like motifs, and a highly acidic C­terminal tail. Follistatin is a secreted protein that binds to ligands of the TGF-Beta family and regulates their activity by inhibiting their access to signaling receptors. It was originally discovered as activin antagonists whose activity suppresses expression and secretion of the pituitary hormone FSH (follicle stimulating hormone). In addition to being a natural antagonist, follistatin can inhibit the activity of other TGF-Beta ligands including BMP-2,-4,-6,-7, Myostatin, GDF-11, and TGF-Beta1. Follistatin is expressed in the pituitary, ovaries, decidual cells of the endometrium, and in some other tissues. Recombinant human Follistatin 315 is a 34.7 kDa protein containing amino acids 30-344 of the FST-344 protein.

Biochemistry
Follistatin is part of the inhibin-activin-follistatin axis.

Currently there are three reported isoforms, FS-288, FS-300, and FS-315. Two, FS-288 and FS-315, are known to be created by alternative splicing of the primary mRNA transcript. FS-300 (porcine follistatin) is thought to be the product of posttranslational modification via truncation of the C-terminal domain from the primary amino-acid chain.

Although FS is ubiquitous its highest concentration has been found to be in the female ovary, followed by the skin.

The activin-binding protein follistatin is produced by folliculostellate (FS) cells of the anterior pituitary. FS cells make numerous contacts with the classical endocrine cells of the anterior pituitary including gonadotrophs.

In the tissues activin has a strong role in cellular proliferation, thereby making follistatin the safeguard against uncontrolled cellular proliferation and also allowing it to function as an instrument of cellular differentiation. Both of these roles are vital in tissue rebuilding and repair, and may account for follistatin’s high presence in the skin.

In the blood, activin and follistatin are both known to be involved in the inflammatory response following tissue injury or pathogenic incursion. The source of follistatin in circulating blood plasma has yet to be determined, but due to its autocrine nature speculation suggests the endothelial cells lining all blood vessels, or the macrophages and monocytes also circulating within the whole blood, may be sources.

Follistatin is involved in the development of the embryo. It has inhibitory action on bone morphogenic proteins (BMPs); BMPs induce the ectoderm to become epidermal ectoderm. Inhibition of BMPs allows neuroectoderm to arise from ectoderm, a process which eventually forms the neural plate. Other inhibitors involved in this process are noggin and chordin.

Follistatin and BMPs are also known to play a role in folliculogenesis within the ovary. The main role of follistatin in the oestrus/menstrus ovary, so far, appears to be progression of the follicle from early antral to antral/dominant, and importantly the promotion of cellular differentiation of the estrogen producing granulosa cells (GC) of the dominant follicle into the progesterone producing large lutein cells (LLC) of the corpus luteum.